Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FPR2 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00002358-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FPR2 protein.
  • Immunogen:
  • FPR2 (NP_001005738.1, 1 a.a. ~ 351 a.a) full-length human protein.
  • Sequence:
  • METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FPR2 expression in transfected 293T cell line (H00002358-T02) by FPR2 MaxPab polyclonal antibody.

    Lane 1: FPR2 transfected lysate(39 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of FPR2 transfected lysate using anti-FPR2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FPR2 MaxPab mouse polyclonal antibody (B01) (H00002358-B01).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2358
  • Gene Name:
  • FPR2
  • Gene Alias:
  • ALXR,FMLP-R-II,FMLPX,FPR2A,FPRH1,FPRH2,FPRL1,HM63,LXA4R
  • Gene Description:
  • formyl peptide receptor 2
  • Other Designations:
  • formyl peptide receptor-like 1,lipoxin A4 receptor (formyl peptide receptor related)
  • RSS
  • YouTube
  • Linkedin
  • Facebook