Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Disease
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

FCGR2A purified MaxPab mouse polyclonal antibody (B01P)   MaxPab

  • Catalog # : H00002212-B01P
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FCGR2A protein.
  • Immunogen:
  • FCGR2A (AAH20823.1, 1 a.a. ~ 316 a.a) full-length human protein.
  • Sequence:
  • MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FCGR2A MaxPab polyclonal antibody. Western Blot analysis of FCGR2A expression in human placenta.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FCGR2A expression in transfected 293T cell line (H00002212-T01) by FCGR2A MaxPab polyclonal antibody.

    Lane 1: FCGR2A transfected lysate(34.90 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2212
  • Gene Name:
  • FCGR2A
  • Gene Alias:
  • CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2,MGC23887,MGC30032
  • Gene Description:
  • Fc fragment of IgG, low affinity IIa, receptor (CD32)
  • Gene Summary:
  • This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Fc fragment of IgG, low affinity IIa, receptor,Fc fragment of IgG, low affinity IIa, receptor for (CD32),Immunoglobulin G Fc receptor II,OTTHUMP00000032377
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!