Product Browser

Last updated: 2014/11/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCER2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00002208-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FCER2 protein.
  • Immunogen:
  • FCER2 (NP_001993.2, 1 a.a. ~ 321 a.a) full-length human protein.
  • Sequence:
  • MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FCER2 expression in transfected 293T cell line (H00002208-T02) by FCER2 MaxPab polyclonal antibody.

    Lane 1: FCER2 transfected lysate(36.50 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2208
  • Gene Name:
  • FCER2
  • Gene Alias:
  • CD23,CD23A,CLEC4J,FCE2,IGEBF
  • Gene Description:
  • Fc fragment of IgE, low affinity II, receptor for (CD23)
  • Gene Summary:
  • The human leukocyte differentiation antigen CD23 (FCE2) is a key molecule for B-cell activation and growth. It is the low-affinity receptor for IgE. The truncated molecule can be secreted, then functioning as a potent mitogenic growth factor.[supplied by OMIM
  • Other Designations:
  • C-type lectin domain family 4, member J,CD23 antigen,Fc fragment of IgE, low affinity II, receptor for (CD23A)
  • RSS
  • YouTube
  • Linkedin
  • Facebook