EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EXTL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of EXTL2 expression in mouse brain.
Western Blot (Cell lysate)
EXTL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of EXTL2 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of EXTL2 expression in transfected 293T cell line (H00002135-T01) by EXTL2 MaxPab polyclonal antibody.
Lane 1: EXTL2 transfected lysate(32.23 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EXTL2 protein.
Immunogen
EXTL2 (AAH36015.1, 39 a.a. ~ 330 a.a) full-length human protein.
Sequence
LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EXTL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of EXTL2 expression in mouse brain.Western Blot (Cell lysate)
EXTL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of EXTL2 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of EXTL2 expression in transfected 293T cell line (H00002135-T01) by EXTL2 MaxPab polyclonal antibody.
Lane 1: EXTL2 transfected lysate(32.23 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EXTL2
Entrez GeneID
2135GeneBank Accession#
BC036015.1Protein Accession#
AAH36015.1Gene Name
EXTL2
Gene Alias
EXTR2
Gene Description
exostoses (multiple)-like 2
Omim ID
602411Gene Ontology
HyperlinkGene Summary
4-N-acteylhexosaminyltransferase|exostosin-like 2|multiple exostoses-like 2
Other Designations
OTTHUMP00000013586|OTTHUMP00000013587|alpha-1,4-N-acteylhexosaminyltransferase|exostosin-like 2|multiple exostoses-like 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com