EEF1A1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EEF1A1 polyclonal antibody (A01). Western Blot analysis of EEF1A1 expression in K-562.
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant EEF1A1.
Immunogen
EEF1A1 (AAH09875, 156 a.a. ~ 255 a.a) partial recombinant protein with GST tag.
Sequence
DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EEF1A1 polyclonal antibody (A01). Western Blot analysis of EEF1A1 expression in K-562.Western Blot (Recombinant protein)
ELISA
-
Gene Info — EEF1A1
Entrez GeneID
1915GeneBank Accession#
BC009875Protein Accession#
AAH09875Gene Name
EEF1A1
Gene Alias
CCS-3, CCS3, EEF-1, EEF1A, EF-Tu, EF1A, FLJ25721, GRAF-1EF, HNGC:16303, LENG7, MGC102687, MGC131894, MGC16224, PTI1, eEF1A-1
Gene Description
eukaryotic translation elongation factor 1 alpha 1
Omim ID
130590Gene Ontology
HyperlinkGene Summary
This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq
Other Designations
CTCL tumor antigen|EF1a-like protein|OTTHUMP00000016736|OTTHUMP00000063804|OTTHUMP00000063805|cervical cancer suppressor 3|elongation factor 1 alpha subunit|elongation factor 1-alpha|elongation factor Tu|eukaryotic translation elongation factor 1 alpha 1-
-
Interactome
-
Publication Reference
-
A rapid and specific method to simultaneously quantify eukaryotic elongation factor 1A1 and A2 protein levels in cancer cells.
Bosutti A, Kalaja O, Zanconati F, Dapas B, Grassi G, Passamonti S, Scaggiante B.
Journal of Pharmaceutical and Biomedical Analysis 2019 Nov; 176:112814.
Application：IF, IHC-P, WB, Human, LoVo109, LoVoDX cells, Pancreas specimen, PC-3, PZHPV-7 cells.
-
EF1A1-Actin interactions alter mRNA stability to determine differential osteopontin expression in HepG2 and Hep3B cells.
Zhang J, Guo H, Mi Z, Gao C, Bhattacharya S, Li J, Kuo PC.
Experimental Cell Research 2008 Nov; 315(2):304.
Application：IP-WB, Human, Hep 3B2.1-7, HepG2 cells.
-
A rapid and specific method to simultaneously quantify eukaryotic elongation factor 1A1 and A2 protein levels in cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com