DHFR monoclonal antibody (M01), clone 2B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DHFR monoclonal antibody (M01), clone 2B10. Western Blot analysis of DHFR expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
DHFR monoclonal antibody (M01), clone 2B10 Western Blot analysis of DHFR expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10.
Lane 1: DHFR transfected lysate(21.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DHFR is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DHFR.
Immunogen
DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DHFR monoclonal antibody (M01), clone 2B10. Western Blot analysis of DHFR expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
DHFR monoclonal antibody (M01), clone 2B10 Western Blot analysis of DHFR expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10.
Lane 1: DHFR transfected lysate(21.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DHFR is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DHFR
Entrez GeneID
1719GeneBank Accession#
BC003584Protein Accession#
AAH03584Gene Name
DHFR
Gene Alias
-
Gene Description
dihydrofolate reductase
Omim ID
126060Gene Ontology
HyperlinkGene Summary
Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Inhibiting homologous recombination decreases extrachromosomal amplification but has no effect on intrachromosomal amplification in methotrexate-resistant colon cancer cells.
Cai M, Zhang H, Hou L, Gao W, Song Y, Cui X, Li C, Guan R, Ma J, Wang X, Han Y, Lv Y, Chen F, Wang P, Meng X, Fu S.
International Journal of Cancer 2018 Aug; [Epub].
Application：WB-Tr, Human, HT-29 cells.
-
The SGLT2 inhibitor empagliflozin improves the primary diabetic complications in ZDF rats.
Steven S, Oelze M, Hanf A, Kröller-Schön S, Kashani F, Roohani S, Welschof P, Kopp M, Gödtel-Armbrust U, Xia N, Li H, Schulz E, Lackner KJ, Wojnowski L, Bottari SP, Wenzel P, Mayoux E, Münzel T, Daiber A.
Redox Biology 2017 Jun; 13:370.
Application：WB-Ti, Rat, Rat artery.
-
Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats.
Jabs A, Oelze M, Mikhed Y, Stamm P, Kröller-Schön S, Welschof P, Jansen T, Hausding M, Kopp M, Steven S, Schulz E, Stasch JP, Münzel T, Daiber A.
Vascular Pharmacology 2015 Aug; 71:181.
Application：WB-Ti, Rat, Aortic.
-
The sodium-glucose co-transporter 2 inhibitor empagliflozin improves diabetes-induced vascular dysfunction in the streptozotocin diabetes rat model by interfering with oxidative stress and glucotoxicity.
Oelze M, Kroller-Schon S, Welschof P, Jansen T, Hausding M, Mikhed Y, Stamm P, Mader M, Zinssius E, Agdauletova S, Gottschlich A, Steven S, Schulz E, Bottari SP, Mayoux E, Munzel T, Daiber A.
PLoS One 2014 Nov; 9(11):e112394.
Application：WB-Ti, Rat, Aortic.
-
Inflammatory Monocytes Determine Endothelial Nitric Oxide Synthase Uncoupling and Nitro-oxidative Stress Induced by Angiotensin II.
Kossmann S, Hu H, Steven S, Schonfelder T, Fraccarollo D, Mikhed Y, Brahler M, Knorr M, Brandt M, Karbach SH, Becker C, Oelze M, Bauersachs J, Widder J, Munzel T, Daiber A, Wenzel P.
The Journal of Biological Chemistry 2014 Oct; 289(40):27540.
Application：WB, Mouse, Aortic tissue.
-
Influence of Reduced Folate Carrier and Dihydrofolate Reductase Genes on Methotrexate-Induced Cytotoxicity.
Yoon SA, Choi JR, Kim JO, Shin JY, Zhang X, Kang JH.
Cancer Research 2010 Sep; 42(3):163.
Application：WB-Ce, Human, AGS, Saos-2 cells.
-
Telomere capping in non-dividing yeast cells requires Yku and Rap1.
Vodenicharov MD, Laterreur N, Wellinger RJ.
The EMBO Journal 2010 Sep; 29(17):3007.
Application：WB, Yeast, MVY401 cells.
-
Anticancer drug encapsulated in inorganic lattice can overcome drug resistance.
Soo-Jin Choi,Go Eun Choi,Jae-Min Oh,Yeon-Ji Oh,Myung-Chul Park and Jin-Ho Choy.
Journal of Materials Chemistry 2010 May; 20:9463.
Application：WB-Ce, Human, HOS, HOS/Mtx cells.
-
Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes.
Ionova IA, Vasquez-Vivar J, Whitsett J, Herrnreiter A, Medhora M, Cooley BC, Pieper GM.
American Journal of Physiology. Heart and Circulatory Physiology 2008 Oct; 295(5):H2178.
Application：WB, Rat, Rat cardiac myocytes.
-
Inhibiting homologous recombination decreases extrachromosomal amplification but has no effect on intrachromosomal amplification in methotrexate-resistant colon cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com