DDT monoclonal antibody (M01), clone 1G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant DDT.
Immunogen
DDT (AAH05971, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Host
Mouse
Reactivity
Human
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.72 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DDT expression in transfected 293T cell line by DDT monoclonal antibody (M01), clone 1G1.
Lane 1: DDT transfected lysate(12.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDT is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — DDT
Entrez GeneID
1652GeneBank Accession#
BC005971Protein Accession#
AAH05971Gene Name
DDT
Gene Alias
DDCT
Gene Description
D-dopachrome tautomerase
Omim ID
602750Gene Ontology
HyperlinkGene Summary
D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq
Other Designations
D-dopachrome decarboxylase
-
Interactomes
-
Diseases
-
Publication Reference
-
D-dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride.
Hiyoshi M, Konishi H, Uemura H, Matsuzaki H, Tsukamoto H, Sugimoto R, Takeda H, Dakeshita S, Kitayama A, Takami H, Sawachika F, Kido H, Arisawa K.
Toxicology 2008 Sep; 255(1-2):6.
Application:WB, Rat, Rat liver.
-
D-dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com