KLF6 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KLF6 full-length ORF ( AAH04301.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
54.34
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KLF6
Entrez GeneID
1316GeneBank Accession#
BC004301.1Protein Accession#
AAH04301.1Gene Name
KLF6
Gene Alias
BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9
Gene Description
Kruppel-like factor 6
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. [provided by RefSeq
Other Designations
B-cell derived 1|core promoter element binding protein|core promoter element-binding protein, N-terminus truncated|prostate adenocarcinoma-1|protooncogene BCD1|suppression of tumorigenicity 12 (prostate)
-
Interactome
-
Disease
-
Publication Reference
-
KLF6 induces apoptosis in prostate cancer cells through up-regulation of ATF3.
Huang X, Li X, Guo B.
The Journal of Biological Chemistry 2008 Aug; 283(44):29795.
Application:Func, Biotin-labeled DNA Probe.
-
KLF6 induces apoptosis in prostate cancer cells through up-regulation of ATF3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com