Product Browser

Last updated: 2014/8/18
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK5 monoclonal antibody (M01A), clone 1A2

  • Catalog # : H00001020-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CDK5.
  • Immunogen:
  • CDK5 (AAH05115, 195 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001020-M01A
    Western Blot detection against Immunogen (36.41 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CDK5 monoclonal antibody (M01A), clone 1A2. Western Blot analysis of CDK5 expression in human lung cancer.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CDK5 expression in transfected 293T cell line by CDK5 monoclonal antibody (M01A), clone 1A2.

    Lane 1: CDK5 transfected lysate (Predicted MW: 33.3 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1020
  • Gene Name:
  • CDK5
  • Gene Alias:
  • PSSALRE
  • Gene Description:
  • cyclin-dependent kinase 5
  • Other Designations:
  • protein kinase CDK5 splicing
  • RSS
  • YouTube
  • Linkedin
  • Facebook