Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CD79B monoclonal antibody (M01), clone 4E10-2A10   

  • Catalog # : H00000974-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant CD79B.
  • Immunogen:
  • CD79B (AAH32651, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000974-M01
    Western Blot detection against Immunogen (50.93 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CD79B monoclonal antibody (M01), clone 4E10-2A10 Western Blot analysis of CD79B expression in Hela ( Cat # L013V1 ).
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of CD79B transfected lysate using anti-CD79B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD79B MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CD79B is approximately 0.03ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 974
  • Gene Name:
  • CD79B
  • Gene Alias:
  • B29,IGB
  • Gene Description:
  • CD79b molecule, immunoglobulin-associated beta
  • Gene Summary:
  • The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • B-cell antigen receptor complex-associated protein beta chain,B-cell-specific glycoprotein B29,CD79B antigen,CD79b antigen (immunoglobulin-associated beta),Ig-beta,immunoglobulin-associated B29
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!