Product Browser

Last updated: 2014/8/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD79B purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000974-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CD79B protein.
  • Immunogen:
  • CD79B (NP_000617.1, 1 a.a. ~ 229 a.a) full-length human protein.
  • Sequence:
  • MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD79B expression in transfected 293T cell line (H00000974-T02) by CD79B MaxPab polyclonal antibody.

    Lane 1: CD79B transfected lysate(25.19 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 974
  • Gene Name:
  • CD79B
  • Gene Alias:
  • B29,IGB
  • Gene Description:
  • CD79b molecule, immunoglobulin-associated beta
  • Gene Summary:
  • The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • B-cell antigen receptor complex-associated protein beta chain,B-cell-specific glycoprotein B29,CD79B antigen,CD79b antigen (immunoglobulin-associated beta),Ig-beta,immunoglobulin-associated B29
  • RSS
  • YouTube
  • Linkedin
  • Facebook