Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD74 (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00000972-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD74 full-length ORF (NP_001020329.1) recombinant protein without tag.
  • Sequence:
  • MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 18.3
  • Form:
  • Liquid
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 972
  • Gene Name:
  • CD74
  • Gene Alias:
  • DHLAG,HLADG,Ia-GAMMA
  • Gene Description:
  • CD74 molecule, major histocompatibility complex, class II invariant chain
  • Other Designations:
  • CD74 antigen,CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated),HLA-DR-gamma,Ia-associated invariant chain,MHC HLA-DR gamma chain,gamma chain of class II antigens
  • RSS
  • YouTube
  • Linkedin
  • Facebook