Product Browser

Last updated: 2014/7/28
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD70 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000970-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CD70 protein.
  • Immunogen:
  • CD70 (NP_001243, 1 a.a. ~ 193 a.a) full-length human protein.
  • Sequence:
  • MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD70 expression in transfected 293T cell line (H00000970-T01) by CD70 MaxPab polyclonal antibody.

    Lane 1: CD70 transfected lysate(21.23 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 970
  • Gene Name:
  • CD70
  • Gene Alias:
  • CD27L,CD27LG,TNFSF7
  • Gene Description:
  • CD70 molecule
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq
  • Other Designations:
  • CD27 ligand,CD70 antigen,Ki-24 antigen,surface antigen CD70,tumor necrosis factor (ligand) superfamily, member 7,tumor necrosis factor ligand superfamily, member 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook