Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Disease
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CD80 monoclonal antibody (M03A), clone 4A4   

  • Catalog # : H00000941-M03A
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 200 uL
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant CD80.
  • Immunogen:
  • CD80 (NP_005182.1, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000941-M03A
    Western Blot detection against Immunogen (53.94 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of CD80 transfected lysate using anti-CD80 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD80 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 941
  • Gene Name:
  • CD80
  • Gene Alias:
  • CD28LG,CD28LG1,LAB7
  • Gene Description:
  • CD80 molecule
  • Gene Summary:
  • The B-lymphocyte activation antigen B7-1 (formerly referred to as B7) provides regulatory signals for T lymphocytes as a consequence of binding to the CD28 (MIM 186760) and CTLA4 (MIM 123890) ligands of T cells.[supplied by OMIM
  • Other Designations:
  • B-lymphocyte activation antigen B7,CD80 antigen,CD80 antigen (CD28 antigen ligand 1, B7-1 antigen),costimulatory factor CD80,costimulatory molecule variant IgV-CD80
  • Interactome
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!