Product Browser

Last updated: 2014/10/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD9 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000928-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD9 partial ORF ( AAH11988, 112 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.98
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000928-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 928
  • Gene Name:
  • CD9
  • Gene Alias:
  • 5H9,BA2,BTCC-1,DRAP-27,GIG2,MIC3,MRP-1,P24,TSPAN29
  • Gene Description:
  • CD9 molecule
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. [provided by RefSeq
  • Other Designations:
  • 5H9 antigen,CD9 antigen,CD9 antigen (p24),OTTHUMP00000041574,OTTHUMP00000041576,antigen defined by monoclonal antibody 602-29,growth-inhibiting gene 2 protein,leukocyte antigen MIC3,motility related protein,motility related protein-1,p24 antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook