Product Browser

Last updated: 2014/11/16
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD9 monoclonal antibody (M01), clone 4A2

  • Catalog # : H00000928-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CD9.
  • Immunogen:
  • CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000928-M01
    Western Blot detection against Immunogen (34.98 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CD9 is approximately 1ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 928
  • Gene Name:
  • CD9
  • Gene Alias:
  • 5H9,BA2,BTCC-1,DRAP-27,GIG2,MIC3,MRP-1,P24,TSPAN29
  • Gene Description:
  • CD9 molecule
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. [provided by RefSeq
  • Other Designations:
  • 5H9 antigen,CD9 antigen,CD9 antigen (p24),OTTHUMP00000041574,OTTHUMP00000041576,antigen defined by monoclonal antibody 602-29,growth-inhibiting gene 2 protein,leukocyte antigen MIC3,motility related protein,motility related protein-1,p24 antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook