- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Disease
- By Application
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Metabolism > CBS monoclonal antibody (M01), clone 3E1
CBS monoclonal antibody (M01), clone 3E1
- Catalog # : H00000875-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant CBS.
- Immunogen:
- CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG2a Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Electroacupuncture Suppresses Mechanical Allodynia and Nuclear Factor Kappa B Signaling in Streptozotocin-Induced Diabetic Rats.
Shi L, Zhang HH, Xiao Y, Hu J, Xu GY.CNS Neurosci Ther. 2012 Dec 11. doi: 10.1111/cns.12035. [Epub ahead of print]
- 2.
- Hydrogen Sulphide-induced relaxation of porcine peripheral bronchioles.
Rashid S, Heer JK, Garle MJ, Alexander SP, Roberts RE.Br J Pharmacol. 2012 Dec 6. doi: 10.1111/bph.12084. [Epub ahead of print]
- 3.
- Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe.
Dufton N, Natividad J, Verdu EF, Wallace JL.Sci Rep. 2012;2:499. Epub 2012 Jul 9.
- 4.
- Characterization of Hydrogen Sulfide and Its Synthases, Cystathionine ?]-Synthase and Cystathionine ?^-Lyase, in Human Prostatic Tissue and Cells.
Guo H, Gai JW, Wang Y, Jin HF, Du JB, Jin J.Urology. 2012 Feb;79(2):483.e1-5.
- 5.
- Homocystinuria in Taiwan: An inordinately high prevalence in an Austronesian aboriginal tribe, Tao.
Lu YH, Huang YH, Cheng LM, Yu HC, Hsu JH, Wu JT, Lo MY, Lin A, Lin CY, Wu JY, Niu DM.Molecular Genetics and Metabolism (2012), doi: 10.1016/j. ymgme.2012.01.021
- 6.
- Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation.
Streeter E, Al-Magableh M, Hart JL, Badoer E.Front Physiol. 2011;2:55. Epub 2011 Sep 1.
- 7.
- Interdependency of Cystathione ?^-Lyase and Cystathione ?]-Synthase in Hydrogen Sulfide-Induced Blood Pressure Regulation in Rats.
Roy A, Khan AH, Islam MT, Prieto MC, Majid DS.Am J Hypertens. 2011 Aug 25. doi: 10.1038/ajh.2011.149. [Epub ahead of print]
- 8.
- Placental markers of folate-related metabolism in preeclampsia.
Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya MY.Reproduction. 2011 Jun 20. [Epub ahead of print]
- 9.
- Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats.
Ren YS, Wu SY, Wang XJ, Yu F, Zhao J, Tang CS, Ouyang JP, Geng B.Chin Med J 2011;124(21):3468-3475
- 10.
- Hydrogen Sulfide Modulates Contractile Function in Rat Jejunum.
Kasparek MS, Linden DR, Farrugia G, Sarr MG.J Surg Res. 2011 Apr 22. [Epub ahead of print]
- 11.
- Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine beta-synthase.
Yamamoto T, Takano N, Ishiwata K, Suematsu M.J. Clin. Biochem. Nutr., 48, 96-100, 2010 .
- 12.
- The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction.
Predmore BL, Alendy MJ, Ahmed KI, Leeuwenburgh C, Julian D.Age (Dordr). 2010 Dec;32(4):467-81. Epub 2010 May 26.
- 13.
- A Crucial Role for Hydrogen Sulfide in Oxygen Sensing via Modulating Large Conductance Calcium-Activated Potassium Channels.
Li Q, Sun B, Wang X, Jin Z, Zhou Y, Dong L, Jiang LH, Rong W.Antioxid Redox Signal. 2010 May 15;12(10):1179-89.
- 14.
- Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes.
Majtan T, Liu L, Carpenter JF, Kraus JP.J Biol Chem. 2010 Mar 22. [Epub ahead of print]
- 15.
- Actions of hydrogen sulphide on ion transport across rat distal colon.
Hennig B, Diener M.Br J Pharmacol. 2009 Nov;158(5):1263-75. Epub 2009 Sep 25.
- 16.
- The endogenous hydrogen sulfide producing enzyme cystathionine-?] synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome.
Xu GY, Winston JH, Shenoy M, Zhou S, Chen JD, Pasricha PJ.Mol Pain. 2009 Aug 6;5:44.
- 17.
- Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide.
Lee M, Schwab C, Yu S, McGeer E, McGeer PL.Neurobiol Aging. 2009 Oct;30(10):1523-34. Epub 2009 Jul 23.
- 18.
- Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract.
Martin GR, McKnight GW, Dicay MS, Coffin CS, Ferraz JG, Wallace JL.Dig Liver Dis. 2009 Jun 29. [Epub ahead of print]
- 19.
- Endogenous and Exogenous Hydrogen Sulfide Promotes Resolution of Colitis in Rats.
Wallace JL, Vong L, McKnight W, Dicay M, Martin GR.Gastroenterology. 2009 Aug;137(2):569-78, 578.e1. Epub 2009 Apr 16.
- 20.
- Active CBS can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone.
Majtan T, Singh LR, Wang L, Kruger WD, Kraus JP.J Biol Chem. 2008 Dec 12;283(50):34588-95. Epub 2008 Oct 10.
- 21.
- Hydrogen sulfide enhances ulcer healing in rats.
Wallace JL, Dicay M, McKnight W, Martin GR.FASEB J. 2007 Dec;21(14):4070-6. Epub 2007 Jul 18.
- 22.
- Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon.
Schicho R, Krueger D, Zeller F, Von Weyhern CW, Frieling T, Kimura H, Ishii I, De Giorgio R, Campi B, Schemann M.Gastroenterology. 2006 Nov;131(5):1542-52. Epub 2006 Aug 18.
- Applications
- Western Blot (Cell lysate)
- CBS monoclonal antibody (M01), clone 3E1 Western Blot analysis of CBS expression in HeLa ( Cat # L013V1 ).
- Protocol Download
- Western Blot (Cell lysate)
- CBS monoclonal antibody (M01), clone 3E1. Western Blot analysis of CBS expression in MCF-7 ( Cat # L046V1 ).
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody (M01), clone 3E1.
Lane 1: CBS transfected lysate(61 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
- Protocol Download
- Immunoprecipitation
- Immunoprecipitation of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CBS MaxPab rabbit polyclonal antibody.
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged CBS is approximately 0.1ng/ml as a capture antibody.
- Protocol Download
- RNAi Knockdown (Antibody validated)
- Western blot analysis of CBS over-expressed 293 cell line, cotransfected with CBS Validated Chimera RNAi ( Cat # H00000875-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CBS monoclonal antibody (M01), clone 3E1 (Cat # H00000875-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
- Protocol Download
- Application Image
- Western Blot (Cell lysate)
- enlarge
- Western Blot (Cell lysate)
- enlarge
- Western Blot (Transfected lysate)
- enlarge
- Western Blot (Recombinant protein)
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- enlarge
- Immunoprecipitation
- enlarge
- Sandwich ELISA (Recombinant protein)
- enlarge
- ELISA
- RNAi Knockdown (Antibody validated)
- enlarge
- Entrez GeneID:
- 875
- GeneBank Accession#:
- NM_000071
- Protein Accession#:
- NP_000062
- Gene Name:
- CBS
- Gene Alias:
- HIP4
- Gene Description:
- cystathionine-beta-synthase
- Omim ID:
- 236200
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. [provided by RefSeq
- Other Designations:
- OTTHUMP00000109416,OTTHUMP00000109418,beta-thionase,cystathionine beta-synthase,methylcysteine synthase,serine sulfhydrase
- Related Disease
- Abnormalities
- Adenocarcinoma
- Alzheimer Disease
- Alzheimer disease
- Aortic Aneurysm, Abdominal
- Arterial Occlusive Diseases
- Arteriosclerosis
- Atherosclerosis
- Attention
- Brain Infarction
- Brain Ischemia
- Brain Neoplasms
- Breast cancer
- Breast Neoplasms
- Calcinosis
- Carcinoma
- Carcinoma, Squamous Cell
- Cardiovascular Diseases
- Carotid Artery, Internal, Dissection
