RUNX1 monoclonal antibody (M06), clone 2C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RUNX1 monoclonal antibody (M06), clone 2C10 Western Blot analysis of RUNX1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RUNX1.
Immunogen
RUNX1 (NP_001001890.1, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RUNX1 monoclonal antibody (M06), clone 2C10 Western Blot analysis of RUNX1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 40 ug/ml] -
Gene Info — RUNX1
Entrez GeneID
861GeneBank Accession#
NM_001001890Protein Accession#
NP_001001890.1Gene Name
RUNX1
Gene Alias
AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB
Gene Description
runt-related transcription factor 1
Gene Ontology
HyperlinkGene Summary
Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
AML1-EVI-1 fusion protein|acute myeloid leukemia 1|aml1 oncogene|core-binding factor, runt domain, alpha subunit 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas.
Niu DF, Kondo T, Nakazawa T, Oishi N, Kawasaki T, Mochizuki K, Yamane T, Katoh R.
Laboratory Investigation 2012 Aug; 92(8):1181.
Application：ICC, IF, IHC-P, WB-Ce, Human, Human malignant thyroid tissue including Follicular carcinoma, Papillary carcinoma, Undifferentiated carcinoma, 8305C, TPC-1, WRO cells.
-
Megakaryocytic expression of miRNA 10a, 17-5p, 20a and 126 in Philadelphia chromosome-negative myeloproliferative neoplasm.
Hussein K, Dralle W, Theophile K, Kreipe H, Bock O.
Annals of Hematology 2008 Sep; 88(4):325.
Application：IHC-P, Human, Human bone marrow.
-
Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com