BRAF monoclonal antibody (M02), clone 3D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BRAF.
Immunogen
BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BRAF monoclonal antibody (M02), clone 3D2. Western Blot analysis of BRAF expression in human pancreas.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BRAF is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK3 and BRAF. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-BRAF mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — BRAF
Entrez GeneID
673GeneBank Accession#
NM_004333Protein Accession#
NP_004324Gene Name
BRAF
Gene Alias
B-RAF1, BRAF1, FLJ95109, MGC126806, MGC138284, RAFB1
Gene Description
v-raf murine sarcoma viral oncogene homolog B1
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. [provided by RefSeq
Other Designations
94 kDa B-raf protein|B-Raf proto-oncogene serine/threonine-protein kinase (p94)|Murine sarcoma viral (v-raf) oncogene homolog B1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Positioning High-Throughput CETSA in Early Drug Discovery through Screening against B-Raf and PARP1.
Shaw J, Dale I, Hemsley P, Leach L, Dekki N, Orme JP, Talbot V, Narvaez AJ, Bista M, Martinez Molina D, Dabrowski M, Main MJ, Gianni D.
SLAS Discovery 2018 Dec; 2472555218813332.
Application:Func, Human, A-375 cells.
-
An analysis of protein-protein interactions in cross-talk pathways reveals CRKL as a novel prognostic marker in hepatocellular carcinoma.
Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY.
Molecular & Cellular Proteomics 2013 May; 12(5):1335.
Application:Profiling, Human, Huh7 cells, Mahlavu cells.
-
Positioning High-Throughput CETSA in Early Drug Discovery through Screening against B-Raf and PARP1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com