PCGF4 monoclonal antibody (M02), clone 4E10-1C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PCGF4.
Immunogen
PCGF4 (AAH11652, 1 a.a. ~ 326 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGSSATSSG
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.6 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCGF4 monoclonal antibody (M02), clone 4E10-1C5 Western Blot analysis of PCGF4 expression in A-549 ( Cat # L025V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PCGF4 expression in transfected 293T cell line by PCGF4 monoclonal antibody (M02), clone 4E10-1C5.
Lane 1: PCGF4 transfected lysate(36.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BMI1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — BMI1
Entrez GeneID
648GeneBank Accession#
BC011652Protein Accession#
AAH11652Gene Name
BMI1
Gene Alias
MGC12685, PCGF4, RNF51
Gene Description
BMI1 polycomb ring finger oncogene
Omim ID
164831Gene Ontology
HyperlinkOther Designations
B lymphoma Mo-MLV insertion region 1 homolog|flvi-2/bmi-1|murine leukemia viral (bmi-1) oncogene homolog|oncogene BMI-1|polycomb group ring finger 4
-
Interactome
-
Publication Reference
-
Proteomics Analysis of Ring1B/Rnf2 Interactors Identifies a Novel Complex with the Fbxl10/Jhdm1B Histone Demethylase and the Bcl6 Interacting Corepressor.
Sanchez C, Sanchez I, Demmers JA, Rodriguez P, Strouboulis J, Vidal M.
Molecular & Cellular Proteomics 2007 Feb; 6(5):820.
Application:WB, Mouse, MEL cells.
-
Proteomics Analysis of Ring1B/Rnf2 Interactors Identifies a Novel Complex with the Fbxl10/Jhdm1B Histone Demethylase and the Bcl6 Interacting Corepressor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com