Product Browser

Last updated: 2014/9/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMI1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000648-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human BMI1 protein.
  • Immunogen:
  • BMI1 (NP_005171.4, 1 a.a. ~ 326 a.a) full-length human protein.
  • Sequence:
  • MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BMI1 expression in transfected 293T cell line (H00000648-T02) by BMI1 MaxPab polyclonal antibody.

    Lane 1: BMI1 transfected lysate(36.90 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 648
  • Gene Name:
  • BMI1
  • Gene Alias:
  • MGC12685,PCGF4,RNF51
  • Gene Description:
  • BMI1 polycomb ring finger oncogene
  • Other Designations:
  • B lymphoma Mo-MLV insertion region 1 homolog,flvi-2/bmi-1,murine leukemia viral (bmi-1) oncogene homolog,oncogene BMI-1,polycomb group ring finger 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook