Product Browser

Last updated: 2014/9/29
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AVPR1A polyclonal antibody (A01)

  • Catalog # : H00000552-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AVPR1A.
  • Immunogen:
  • AVPR1A (NP_000697, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000552-A01
    Western Blot detection against Immunogen (31.83 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 552
  • Gene Name:
  • AVPR1A
  • Gene Alias:
  • AVPR1
  • Gene Description:
  • arginine vasopressin receptor 1A
  • Gene Summary:
  • The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq
  • Other Designations:
  • SCCL vasopressin subtype 1a receptor,V1-vascular vasopressin receptor AVPR1A,V1a vasopressin receptor,antidiuretic hormone receptor 1A,vascular/hepatic-type arginine vasopressin receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook