RHOC purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RHOC expression in transfected 293T cell line (H00000389-T02) by RHOC MaxPab polyclonal antibody.
Lane 1: RHOC transfected lysate(22.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RHOC protein.
Immunogen
RHOC (NP_786886.1, 1 a.a. ~ 193 a.a) full-length human protein.
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RHOC expression in transfected 293T cell line (H00000389-T02) by RHOC MaxPab polyclonal antibody.
Lane 1: RHOC transfected lysate(22.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RHOC
Entrez GeneID
389GeneBank Accession#
NM_175744Protein Accession#
NP_786886.1Gene Name
RHOC
Gene Alias
ARH9, ARHC, H9, MGC1448, MGC61427, RHOH9
Gene Description
ras homolog gene family, member C
Omim ID
165380Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000013675|OTTHUMP00000013676|OTTHUMP00000013802|OTTHUMP00000013805|OTTHUMP00000013807|OTTHUMP00000013809|RAS-related homolog 9|Rho-related GTP-binding protein RhoC|oncogene RHO H9|rhoC GTPase|small GTP binding protein RhoC
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com