Product Browser

Last updated: 2014/9/1

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FASLG (Human) Recombinant Protein (Q01)

  • Catalog # : H00000356-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FASLG partial ORF (AAH17502.1, 172 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000356-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 356
  • Gene Name:
  • FASLG
  • Gene Alias:
  • APT1LG1,CD178,CD95L,FASL,TNFSF6
  • Gene Description:
  • Fas ligand (TNF superfamily, member 6)
  • Gene Summary:
  • The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq
  • Other Designations:
  • CD95 ligand,OTTHUMP00000032708,apoptosis (APO-1) antigen ligand 1,fas ligand,tumor necrosis factor (ligand) superfamily, member 6
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook