Product Browser

Last updated: 2014/9/1
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FASLG purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000356-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FASLG protein.
  • Immunogen:
  • FASLG (AAH17502.1, 1 a.a. ~ 281 a.a) full-length human protein.
  • Sequence:
  • MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FASLG expression in transfected 293T cell line (H00000356-T01) by FASLG MaxPab polyclonal antibody.

    Lane 1: FASLG transfected lysate(31.50 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between FASLG and FYN. HeLa cells were stained with anti-FASLG rabbit purified polyclonal 1:1200 and anti-FYN mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 356
  • Gene Name:
  • FASLG
  • Gene Alias:
  • APT1LG1,CD178,CD95L,FASL,TNFSF6
  • Gene Description:
  • Fas ligand (TNF superfamily, member 6)
  • Gene Summary:
  • The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq
  • Other Designations:
  • CD95 ligand,OTTHUMP00000032708,apoptosis (APO-1) antigen ligand 1,fas ligand,tumor necrosis factor (ligand) superfamily, member 6
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook