Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Disease
  • By Biomarker
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

APEX1 MaxPab mouse polyclonal antibody (B01)   MaxPab

  • Catalog # : H00000328-B01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human APEX1 protein.
  • Immunogen:
  • APEX1 (NP_001632, 1 a.a. ~ 318 a.a) full-length human protein.
  • Sequence:
  • MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • APEX1 MaxPab polyclonal antibody. Western Blot analysis of APEX1 expression in human liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of APEX1 expression in transfected 293T cell line (H00000328-T01) by APEX1 MaxPab polyclonal antibody.

    Lane 1: APEX1 transfected lysate(34.98 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)enlargeenlarge this image
  • Immunoperoxidase of purified MaxPab antibody to APEX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 328
  • Gene Name:
  • APEX1
  • Gene Alias:
  • APE,APE-1,APE1,APEN,APEX,APX,HAP1,REF-1,REF1
  • Gene Description:
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • Gene Summary:
  • Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq
  • Other Designations:
  • AP endonuclease class I,AP lyase,APEX nuclease,DNA-(apurinic or apyrimidinic site) lyase,OTTHUMP00000163988,apurinic/apyrimidinic (abasic) endonuclease,apurinic/apyrimidinic exonuclease,deoxyribonuclease (apurinic or apyrimidinic),multifunctional DNA repa
  • Gene Pathway
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!