NUDT2 monoclonal antibody (M03), clone S1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT2 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (41.91 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant NUDT2.
Immunogen
NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.91 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — NUDT2
Entrez GeneID
318GeneBank Accession#
BC004926Protein Accession#
AAH04926Gene Name
NUDT2
Gene Alias
APAH1, MGC10404
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 2
Omim ID
602852Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq
Other Designations
Ap4A hydrolase 1|Ap4Aase|OTTHUMP00000021256|OTTHUMP00000021257|OTTHUMP00000021258|OTTHUMP00000021259|bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)|diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase|diadenosine tetraphosphatase|nudix-type mot
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com