NUDT2 monoclonal antibody (M01), clone 4A4-3C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NUDT2.
Immunogen
NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.91 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NUDT2 monoclonal antibody (M01), clone 4A4-3C3 Western Blot analysis of NUDT2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NUDT2 expression in transfected 293T cell line by NUDT2 monoclonal antibody (M01), clone 4A4-3C3.
Lane 1: NUDT2 transfected lysate(16.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — NUDT2
Entrez GeneID
318GeneBank Accession#
BC004926Protein Accession#
AAH04926Gene Name
NUDT2
Gene Alias
APAH1, MGC10404
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 2
Omim ID
602852Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq
Other Designations
Ap4A hydrolase 1|Ap4Aase|OTTHUMP00000021256|OTTHUMP00000021257|OTTHUMP00000021258|OTTHUMP00000021259|bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)|diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase|diadenosine tetraphosphatase|nudix-type mot
-
Interactome
-
Pathway
-
Publication Reference
-
Nudix-type motif 2 (NUDT2) in human breast carcinoma: A potent prognostic factor associated with cell proliferation.
Oka K, Suzuki T, Onodera Y, Miki Y, Takagi K, Nagasaki S, Akahira JI, Ishida T, Watanabe M, Hirakawa H, Ohuchi N, Sasano H.
International Journal of Cancer 2011 Apr; 128(8):1770.
Application:IHC-P, WB-Tr, Human, Human breast carcinoma, T-47D, MCF-7 cells.
-
Nudix-type motif 2 (NUDT2) in human breast carcinoma: A potent prognostic factor associated with cell proliferation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com