- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Proteins/Peptides > Human > Partial-length > Binding > AK3L1 (Human) Recombinant Protein (Q01)
AK3L1 (Human) Recombinant Protein (Q01)
- Catalog # : H00000205-Q01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 10 ug
- USD $ 319
- order now, ship in 5 days
-
- 25 ug
- USD $ 485
- order now, ship in 5 days
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Human AK3L1 partial ORF ( NP_982289, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
- Sequence:
- MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVI
- Theoretical MW (kDa):
- 37.84
- Preparation Method:
- in vitro wheat germ expression system
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Quality Control Testing:
- 12.5% SDS-PAGE Stained with Coomassie Blue.
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage Instruction:
- Store at -80°C. Aliquot to avoid repeated freezing and thawing.
- Note:
- Best use within three months from the date of receipt of this protein.
- MSDS:
Download
- Application Image
- Enzyme-linked Immunoabsorbent Assay
- Western Blot (Recombinant protein)
- Antibody Production
- Protein Array
- Entrez GeneID:
- 205
- GeneBank Accession#:
- NM_203464
- Protein Accession#:
- NP_982289
- Gene Name:
- AK3L1
- Gene Alias:
- AK3,AK4,MGC166959
- Gene Description:
- adenylate kinase 3-like 1
- Omim ID:
- 103030
- Gene Ontology:
- Hyperlink
- Gene Summary:
- This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq
- Other Designations:
- ATP-AMP transphosphorylase,GTP:AMP phosphotransferase,OTTHUMP00000010594,mitochondrial adenylate kinase-3,nucleoside-triphosphate-adenylate kinase
- Gene Pathway
- Related Disease
