Product Browser

Last updated: 2014/11/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACP5 (Human) Recombinant Protein (Q02)

  • Catalog # : H00000054-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ACP5 partial ORF ( AAH25414.1, 72 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.31
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000054-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 54
  • Gene Name:
  • ACP5
  • Gene Alias:
  • MGC117378,TRAP
  • Gene Description:
  • acid phosphatase 5, tartrate resistant
  • Gene Summary:
  • This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq
  • Other Designations:
  • TrATPase,tartrate resistant acid phosphatase 5,tartrate-resistant acid ATPase
  • RSS
  • YouTube
  • Linkedin
  • Facebook